PSMG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233820

Catalog No. NBP233820

Description

PSMG1 Polyclonal specifically detects PSMG1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PSMG1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
• Gene Accession No.: O95456
• Gene Symbols: PSMG1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C21-LRP, C21LRPc21-LRP, Chromosome 21 leucine-rich protein, Down syndrome critical region gene 2, DSCR2leucine rich protein C21-LRP, LRPC21, PAC-1, PAC1Down syndrome critical region protein 2, proteasome (prosome, macropain) assembly chaperone 1, proteasome assembling chaperone 1, proteasome assembly chaperone 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8624
• Target Species: Human
• Isotype: IgG

For Research Use Only