Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSPC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$416.50 - $682.00

Specifications

Antigen	PSPC1
Dilution	Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen PSPC1 antibody validated for IHC-FR from a verified customer review.
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB418749 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18380125UL	25 μL	Each for $416.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP183801 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP183801	0.1 mL	Each for $682.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PSPC1 Polyclonal specifically detects PSPC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen	PSPC1
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	55269
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen PSPC1 antibody validated for IHC-FR from a verified customer review.
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human, Mouse, Rat
Gene Alias	FLJ33554, paraspeckle component 1, paraspeckle protein 1, PSP1
Gene Symbols	PSPC1
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PSPC1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents