Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSTK Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | PSTK |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17069020
|
Novus Biologicals
NBP17069020UL |
20 μL |
Each for $152.22
|
|
NBP170690
|
Novus Biologicals
NBP170690 |
100 μL |
Each for $436.00
|
|
Description
PSTK Polyclonal specifically detects PSTK in Human samples. It is validated for Western Blot.Specifications
| PSTK | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 118672 | |
| Synthetic peptides corresponding to PSTK(phosphoseryl-tRNA kinase) The peptide sequence was selected from the middle region of PSTK. Peptide sequence SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| phosphoseryl-tRNA kinase | |
| PSTK | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title