PTBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157124

Catalog No. NBP157124

Description

PTBP1 Polyclonal specifically detects PTBP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PTBP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Heterogeneous nuclear ribonucleoprotein I, heterogeneous nuclear ribonucleoprotein polypeptide I, hnRNP I, HNRNPI, HNRNP-I, HNRPI, MGC10830, MGC8461, polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoproteinI), polypyrimidine tract binding protein 1, polypyrimidine tract-binding protein 1, pPTB, PTB-1, PTB2, PTB3, PTB4, PTB57 kDa RNA-binding protein PPTB-1, PTB-T, RNA-binding protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5725
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q29099
• Gene Symbols: PTBP1
• Immunogen: Synthetic peptides corresponding to PTBP1(polypyrimidine tract binding protein 1) The peptide sequence was selected from the middle region of PTBP1. Peptide sequence KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only