Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTEN2/TPTE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PTEN2/TPTE |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
PTEN2/TPTE Polyclonal specifically detects PTEN2/TPTE in Human samples. It is validated for Western Blot.Specifications
PTEN2/TPTE | |
Polyclonal | |
Purified | |
RUO | |
P56180-2 | |
7179 | |
Synthetic peptides corresponding to TPTE (transmembrane phosphatase with tensin homology) The peptide sequence was selected from the C terminal of TPTE. Peptide sequence MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV. | |
Primary |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
Cancer/testis antigen 44, EC 3.1.3.48, PTEN2, putative tyrosine-protein phosphatase TPTE, tensin, putative protein-tyrosine phosphatase, transmembrane phosphatase with tensin homologytensin, putative protein-tyrosine phosphatase, EC 3.1.3.4810CT44PTEN-related tyrosine phosphatase, Tumor antigen BJ-HCC-5 | |
TPTE | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title