Invitrogen™ PTGER4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595439

Catalog No. PIPA595439

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: SW620 whole cell, MCF-7 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2. This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1, regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses.

Specifications

• Antigen: PTGER4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PTGER4
• Gene Alias: EP1; EP4; EP4R; MGC126583; PGE receptor EP4 subtype; PGE receptor, EP4 subtype; PGE2 receptor EP4 subtype; prostaglandin E receptor 4; prostaglandin E receptor 4 (subtype EP4); prostaglandin E2 receptor EP4 subtype; prostaglandin E2 receptor type 4; prostanoid EP4 receptor; Ptger; PTGER2; Ptger4; Ptgerep4
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5734
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P35408
• Gene Symbols: PTGER4
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG