PTP alpha/PTPRA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257255

Catalog No. NBP257255

Description

PTP alpha/PTPRA Polyclonal specifically detects PTP alpha/PTPRA in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PTP alpha/PTPRA
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: EC 3.1.3.48, HEPTP, LRPHPTPalpha, protein tyrosine phosphatase, receptor type, A, Protein-tyrosine phosphatase alpha, PTPAreceptor type, alpha polypeptide, PTPLCA-related phosphatase, receptor-type tyrosine-protein phosphatase alpha, RPTPA, R-PTP-alpha, tyrosine phosphatase alpha
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PTPRA
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPP
• Quantity: 100 μL
• Research Discipline: GPCR, Protein Phosphatase, Signal Transduction
• Gene ID (Entrez): 5786
• Target Species: Human
• Isotype: IgG

For Research Use Only