PTP pi/PTPRU Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18187325UL

Catalog No. NB433618

Description

PTP pi/PTPRU Polyclonal specifically detects PTP pi/PTPRU in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PTP pi/PTPRU
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: FMI, hPTP-J, pancreatic carcinoma phosphatase 2, PCP2, PCP-2, pi R-PTP-Psi, protein tyrosine phosphatase J, protein tyrosine phosphatase, receptor type, U, protein-tyrosine phosphatase J, protein-tyrosine phosphatase pi, PTP, PTP pi, PTP-J, PTP-PI, PTPPSI, PTP-RO, Receptor protein tyrosine phosphatase hPTP-J, R-PTP-PSI
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10076
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PTPRU
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only