Invitrogen™ PTP4A2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579893

Catalog No. PIPA579893

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human MOLT-4 whole cell, human T-47D whole cell, human Daudi whole cell, human RT4 whole cell, rat PC-12 whole cell. IHC: Human Prostatic Cancer tissue. Flow: U937 cell, MCF-7 cell, A431 cell.

PRL-2, also known as Protein tyrosine phosphatase 4a2 (Ptp4a2) is a unique nuclear protein tyrosine phosphatase (PTP) that plays a central role in regulating diverse cellular processes. PRL-1 is induced in mitogen-stimulated cells and regenerating liver. PRL-2 exhibits 87% identity to PRL-1 in their amino acid sequences. All mouse PRL proteins contain a C-terminal consensus sequence for prenylation. All PRL proteins bear significant sequence homology to Cdc14p and the tumor suppressor PTEN/MMAC1. PRL-2 is preferentially expressed in skeletal muscle. PRL-2 is also expressed at lower levels in other tissues.

Specifications

• Antigen: PTP4A2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PTP4A2
• Gene Alias: BM-008; HH13; HH7-2; HU-PP-1; OV-1; phosphatase of regenerating liver 2; PRL2; PRL-2; protein tyrosine phosphatase 4a2; protein tyrosine phosphatase IVA; protein tyrosine phosphatase IVA2; protein tyrosine phosphatase type IVA 2; protein tyrosine phosphatase type IVA, member 2; protein-tyrosine phosphatase 4a2; Protein-tyrosine phosphatase of regenerating liver 2; PTP(CAAXII); PTP4A; Ptp4a2; PTPCAAX2; ptp-IV1a; ptp-IV1b; tyrosine-phosphatase
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 8073, 85237
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q12974, Q6P9X4
• Gene Symbols: PTP4A2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG