Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTPIP51 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162474
Description
PTPIP51 Polyclonal specifically detects PTPIP51 in Human samples. It is validated for Western Blot.Specifications
PTPIP51 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q96TC7 | |
RMDN3 | |
Synthetic peptides corresponding to PTPIP51 The peptide sequence was selected from the middle region of PTPIP51. Peptide sequence LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA. | |
Affinity Purified | |
RUO | |
55177 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Cerebral protein 10, FAM82Cmicrotubule-associated protein, family with sequence similarity 82, member A2, FLJ10579, hRMD-3, Protein FAM82A2, Protein FAM82C, Protein tyrosine phosphatase-interacting protein 51, ptpip51, PTPIP51family with sequence similarity 82, member C, regulator of microtubule dynamics 3, regulator of microtubule dynamics protein 3, RMD3, RMD-3, TCPTP-interacting protein 51 | |
Rabbit | |
52 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title