PTPLAD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159028

Catalog No. NBP159028

Description

PTPLAD1 Polyclonal specifically detects PTPLAD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PTPLAD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: PTPLAD1
• Immunogen: Synthetic peptides corresponding to PTPLAD1(protein tyrosine phosphatase-like A domain containing 1) The peptide sequence was selected from the N terminal of PTPLAD1. Peptide sequence WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFL.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51495
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: B-ind1, BIND1, Butyrate-induced protein 1, butyrate-induced transcript 1, EC 4.2.1.-, FLJ90376, HACD3, hB-ind1, HSPC121,3-hydroxyacyl-CoA dehydratase 3, protein tyrosine phosphatase-like A domain containing 1, Protein tyrosine phosphatase-like protein PTPLAD1, Protein-tyrosine phosphatase-like A domain-containing protein 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Canine: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only