Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTPRD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24915325UL
Description
PTPRD Polyclonal antibody specifically detects PTPRD in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
PTPRD | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
HPTPDELTA, HPTPMGC119752, MGC119750, MGC119751, protein tyrosine phosphatase, receptor type, D, Protein-tyrosine phosphatase delta, PTPDMGC119753, receptor type, delta polypeptide, receptor-type tyrosine-protein phosphatase delta | |
This antibody was developed against a recombinant protein corresponding to amino acids: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE | |
25 μL | |
Neuroscience, Signal Transduction | |
5789 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human, Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction