Invitrogen™ PTPRF Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579898

Catalog No. PIPA579898

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, A431 whole cell, A549 whole cell. IHC: human lung cancer tissue.

Possible cell adhesion receptor. It possesses an intrinsic protein tyrosine phosphatase activity (PTPase).The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate.

Specifications

• Antigen: PTPRF
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PTPRF
• Gene Alias: AA591035; BNAH2; FLJ43335; FLJ45062; FLJ45567; LAR; LAR protein; LARFN5C; LARS; LCA homolog; LCA-homolog; leukocyte antigen-related (LAR) PTP receptor; leukocyte antigen-related tyrosine phosphatase; leukocyte common antigen related; protein tyrosine phosphatase receptor-type F; protein tyrosine phosphatase, receptor type F; protein tyrosine phosphatase, receptor type, F; protein tyrosine phosphatase, receptor type, F polypeptide; Ptprf; PTPRF protein; receptor-linked protein-tyrosine phosphatase LAR; receptor-type tyrosine-protein phosphatase F; RPTP-LAR
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5792
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P10586
• Gene Symbols: PTPRF
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167-1203aa EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG