Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTPRK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | PTPRK |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PTPRK Polyclonal specifically detects PTPRK in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PTPRK | |
Polyclonal | |
Rabbit | |
Protein Phosphatase | |
DKFZp686C2268, DKFZp779N1045, EC 3.1.3.48, protein tyrosine phosphatase kappa protein tyrosine phosphatase kappa, protein tyrosine phosphatase, receptor type, K, Protein-tyrosine phosphatase kappa, protein-tyrosine phosphatase, receptor type, kappa, PTPK, receptor type, K (R-PTP-KAPPA, receptor-type tyrosine-protein phosphatase kappa | |
PTPRK | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
5796 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTM | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title