Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PWP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PWP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PWP1 Polyclonal specifically detects PWP1 in Human samples. It is validated for Western Blot.Specifications
PWP1 | |
Polyclonal | |
Rabbit | |
NP_008993 | |
11137 | |
Synthetic peptide directed towards the C terminal of human PWP1The immunogen for this antibody is PWP1. Peptide sequence FCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
IEF-SSP-9502, Keratinocyte protein IEF SSP 9502, nuclear phosphoprotein similar to S. cerevisiae PWP1, periodic tryptophan protein 1 homolog, PWP1 homolog (S. cerevisiae) | |
PWP1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title