Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PWP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PWP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PWP1 Polyclonal specifically detects PWP1 in Human samples. It is validated for Western Blot.Specifications
| PWP1 | |
| Polyclonal | |
| Rabbit | |
| NP_008993 | |
| 11137 | |
| Synthetic peptide directed towards the C terminal of human PWP1The immunogen for this antibody is PWP1. Peptide sequence FCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| IEF-SSP-9502, Keratinocyte protein IEF SSP 9502, nuclear phosphoprotein similar to S. cerevisiae PWP1, periodic tryptophan protein 1 homolog, PWP1 homolog (S. cerevisiae) | |
| PWP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title