Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PWP2H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PWP2H |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PWP2H Polyclonal specifically detects PWP2H in Human samples. It is validated for Western Blot.Specifications
PWP2H | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
periodic tryptophan protein 2 homolog, PWP2 (periodic tryptophan protein, yeast) homolog, PWP2 periodic tryptophan protein homolog (yeast), PWP2HEHOC-17 | |
PWP2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q15269 | |
5822 | |
Synthetic peptides corresponding to PWP2(PWP2 periodic tryptophan protein homolog (yeast)) The peptide sequence was selected from the middle region of PWP2. Peptide sequence VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title