Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PWWP2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$501.50
Specifications
Antigen | PWWP2A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PWWP2A Polyclonal specifically detects PWWP2A in Human samples. It is validated for Western Blot.Specifications
PWWP2A | |
Polyclonal | |
Rabbit | |
KIAA1935, MST101, MSTP101, PWWP domain containing 2A, PWWP domain-containing protein 2A | |
PWWP2A | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
114825 | |
Synthetic peptides corresponding to PWWP2A(PWWP domain containing 2A) The peptide sequence was selected from the C terminal of PWWP2A. Peptide sequence PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title