Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PYCRL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24961125UL
Description
PYCRL Polyclonal antibody specifically detects PYCRL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
PYCRL | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
EC 1.5.1.2, FLJ13852, P5C reductase 3, P5CR 3, pyrroline-5-carboxylate reductase 3, pyrroline-5-carboxylate reductase-like, Pyrroline-5-carboxylate reductase-like protein | |
This antibody was developed against a recombinant protein corresponding to amino acids: KMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSR | |
25 μL | |
metabolism | |
65263 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction