Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PYHIN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$493.10
Specifications
| Antigen | PYHIN1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179436
|
Novus Biologicals
NBP179436 |
100 μL |
Each for $493.10
|
|
|||||
|
NBP17943620
|
Novus Biologicals
NBP17943620UL |
20 μL | N/A | N/A | N/A | ||||
Description
PYHIN1 Polyclonal specifically detects PYHIN1 in Human samples. It is validated for Western Blot.Specifications
| PYHIN1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| IFIXMGC23885, Interferon-inducible protein X, pyrin and HIN domain family, member 1, pyrin and HIN domain-containing protein 1, RP11-520H16.1 | |
| PYHIN1 | |
| IgG | |
| 51 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_945148 | |
| 149628 | |
| Synthetic peptide directed towards the N terminal of human PYHIN1The immunogen for this antibody is PYHIN1. Peptide sequence KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title