Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PYHIN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | PYHIN1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17943620
![]() |
Novus Biologicals
NBP17943620UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179436
![]() |
Novus Biologicals
NBP179436 |
100 μL |
Each for $487.50
|
|
|||||
Description
PYHIN1 Polyclonal specifically detects PYHIN1 in Human samples. It is validated for Western Blot.Specifications
PYHIN1 | |
Polyclonal | |
Rabbit | |
Human | |
IFIXMGC23885, Interferon-inducible protein X, pyrin and HIN domain family, member 1, pyrin and HIN domain-containing protein 1, RP11-520H16.1 | |
PYHIN1 | |
IgG | |
51 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_945148 | |
149628 | |
Synthetic peptide directed towards the N terminal of human PYHIN1The immunogen for this antibody is PYHIN1. Peptide sequence KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title