Pyruvate Dehydrogenase E2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154756

Catalog No. NBP154756

Description

Pyruvate Dehydrogenase E2 Polyclonal specifically detects Pyruvate Dehydrogenase E2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Pyruvate Dehydrogenase E2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 70 kDa mitochondrial autoantigen of primary biliary cirrhosis, dihydrolipoamide S-acetyltransferase, DLTA, E2 component of pyruvate dehydrogenase complex, EC 2.3.1, M2 antigen complex 70 kDa subunit, PBC, PDC-E2EC 2.3.1.12, PDCE2mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 69 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 1737
• Target Species: Human, Mouse, Rat, Pig, Canine, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q86YI5
• Gene Symbols: DLAT
• Immunogen: Synthetic peptides corresponding to DLAT(dihydrolipoamide S-acetyltransferase) The peptide sequence was selected from the C terminal of DLAT. Peptide sequence DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.