Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP185955
Description
Pyruvate Dehydrogenase Kinase 1/PDK1 Polyclonal specifically detects Pyruvate Dehydrogenase Kinase 1/PDK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Pyruvate Dehydrogenase Kinase 1/PDK1 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 | |
Q15118 | |
PDK1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EC 2.7.11, EC 2.7.11.2, mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1, PDH kinase 1, PDK1, PDK-1, PKB kinase, Pyruvate dehydrogenase kinase isoform 1, pyruvate dehydrogenase kinase, isoenzyme 1, pyruvate dehydrogenase kinase, isozyme 1, Pyruvate dehydrogenase lipoamide kinase isozyme 1, mitochondrial | |
Rabbit | |
49 kDa | |
0.1 mL | |
Autophagy, Cancer, Cytoskeleton Markers, Hypoxia, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction | |
5163 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction