Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody, Novus Biologicals™

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody, Novus Biologicals™
SDP

Catalog No. NB406129 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB406129 25 μL
NBP187309 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB406129 Supplier Novus Biologicals Supplier No. NBP18730925UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Polyclonal specifically detects Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial, EC 3.1.3, EC 3.1.3.43, MGC119646, PDH, PDP 1, PDPC, PDPC 1, PDPFLJ32517, PPM2CFLJ56179, Protein phosphatase 2C, protein phosphatase 2C, magnesium-dependent, catalytic subunit, pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase, Pyruvate dehydrogenase phosphatase catalytic subunit 1, pyruvate dehyrogenase phosphatase catalytic subunit 1
Gene Symbols PDP1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54704
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.