Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ PYY Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579900
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579900 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579900 Supplier Invitrogen™ Supplier No. PA579900
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse pancreas tissue, mouse intestine tissue, mouse intestine tissue, rat intestine tissue, rat pancreas tissue.

Peptide tyrosine-tyrosine amide (3-36), or PYY (3-36), is a major metabolite of the gut hormone PYY and is produced by the action of dipeptidyl peptidase IV on PYY in the intestinal brush border and in the circulation. PYY (3-36) is a potent inhibitor of food intake in rats and humans, acting selectively on the Y2 receptor to inhibit orexigenic NPY neurons in the arcuate nucleus, thus disinhibiting anorexigenic POMC neurons. The anorexigenic effect of PYY (3-36) is additive to that of the co-secreted gut hormone GLP-1.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PYY
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.01mg sodium azide
Gene Pyy
Gene Accession No. P10631, Q9EPS2
Gene Alias GHYY; Peptide tyrosine tyrosine; peptide tyrosine-tyrosine (YY); peptide YY; peptide YY (mapped); Peptide YY(3-36); Peptide YY3-36; Peptide YY3-37; peptide-YY; prepro-PYY; PYY; PYY II; PYY1; PYY-1; PYY-2; PYYI; PYY-I; PYYII; PYY-II; RATGHYY; Yy
Gene Symbols Pyy
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 217212, 287730
Target Species Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.