Invitrogen™ PYY Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579900

Catalog No. PIPA579900

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse pancreas tissue, mouse intestine tissue, mouse intestine tissue, rat intestine tissue, rat pancreas tissue.

Peptide tyrosine-tyrosine amide (3-36), or PYY (3-36), is a major metabolite of the gut hormone PYY and is produced by the action of dipeptidyl peptidase IV on PYY in the intestinal brush border and in the circulation. PYY (3-36) is a potent inhibitor of food intake in rats and humans, acting selectively on the Y2 receptor to inhibit orexigenic NPY neurons in the arcuate nucleus, thus disinhibiting anorexigenic POMC neurons. The anorexigenic effect of PYY (3-36) is additive to that of the co-secreted gut hormone GLP-1.

Specifications

• Antigen: PYY
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Pyy
• Gene Alias: GHYY; Peptide tyrosine tyrosine; peptide tyrosine-tyrosine (YY); peptide YY; peptide YY (mapped); Peptide YY(3-36); Peptide YY3-36; Peptide YY3-37; peptide-YY; prepro-PYY; PYY; PYY II; PYY1; PYY-1; PYY-2; PYYI; PYY-I; PYYII; PYY-II; RATGHYY; Yy
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 217212, 287730
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P10631, Q9EPS2
• Gene Symbols: Pyy
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov