Invitrogen™ PYY Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595608

Catalog No. PIPA595608

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: human appendicitis tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Peptide tyrosine-tyrosine amide (3-36), or PYY (3-36), is a major metabolite of the gut hormone PYY and is produced by the action of dipeptidyl peptidase IV on PYY in the intestinal brush border and in the circulation. PYY (3-36) is a potent inhibitor of food intake in rats and humans, acting selectively on the Y2 receptor to inhibit orexigenic NPY neurons in the arcuate nucleus, thus disinhibiting anorexigenic POMC neurons. The anorexigenic effect of PYY (3-36) is additive to that of the co-secreted gut hormone GLP-1.

Specifications

• Antigen: PYY
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Pyy
• Gene Alias: GHYY; Peptide tyrosine tyrosine; peptide tyrosine-tyrosine (YY); peptide YY; peptide YY (mapped); Peptide YY(3-36); Peptide YY3-36; Peptide YY3-37; peptide-YY; prepro-PYY; PYY; PYY II; PYY1; PYY-1; PYY-2; PYYI; PYY-I; PYYII; PYY-II; RATGHYY; Yy
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5697
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin)
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P10082
• Gene Symbols: Pyy
• Immunogen: A synthetic peptide corresponding to a sequence of human Peptide YY/PYY (YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG