QARS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179632

Catalog No. NBP179632

Description

QARS Polyclonal specifically detects QARS in Human samples. It is validated for Western Blot.

Specifications

• Antigen: QARS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.1.1, EC 6.1.1.18, GLNRS, glutamine tRNA ligase, Glutamine--tRNA ligase, glutamine-tRNA synthetase, glutaminyl-tRNA synthetase, PRO2195
• Host Species: Rabbit
• Molecular Weight of Antigen: 88 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Chicken: 92%; Guinea pig: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_005042
• Gene Symbols: QARS1
• Immunogen: Synthetic peptide directed towards the N terminal of human QARSThe immunogen for this antibody is QARS. Peptide sequence DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5859
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.