Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
QARS Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | QARS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179632
|
Novus Biologicals
NBP179632 |
100 μL |
Each of 1 for $436.00
|
|
Description
QARS Polyclonal specifically detects QARS in Human samples. It is validated for Western Blot.Specifications
QARS | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 6.1.1, EC 6.1.1.18, GLNRS, glutamine tRNA ligase, Glutamine--tRNA ligase, glutamine-tRNA synthetase, glutaminyl-tRNA synthetase, PRO2195 | |
Synthetic peptide directed towards the N terminal of human QARSThe immunogen for this antibody is QARS. Peptide sequence DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
NP_005042 | |
5859 | |
IgG | |
Affinity Purified | |
88 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title