Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. QTRT1 Antibody, Novus Biologicals™

QTRT1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15305620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15305620 20 μL
NBP153056 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15305620 Supplier Novus Biologicals Supplier No. NBP15305620UL

Description

Rabbit Polyclonal Antibody

QTRT1 Polyclonal specifically detects QTRT1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen QTRT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q80VS3
Gene Alias EC 2.4.2.29, Guanine insertion enzyme, queuine tRNA-ribosyltransferase, queuine tRNA-ribosyltransferase 1, TGTFP3235, TGUT, tRNA-guanine transglycosylase
Gene Symbols QTRT1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to QTRT1(queuine tRNA-ribosyltransferase 1 (tRNA-guanine transglycosylase)) The peptide sequence was selected from the middle region of QTRT1. Peptide sequence KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTG
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 81890
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.