Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ RAB11A Monoclonal Antibody (4H9)
GREENER_CHOICE

Catalog No. PIMA549197
Change view
Click to view available options
Quantity:
100 μg
Catalog No. Quantity
PIMA549197 100 μg
1 options

Catalog No. PIMA549197

Supplier: Invitrogen™ MA549197

Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse and rat sequences. Positive Control - WB: human 293T whole cell, human SH-SY5Y whole cell, human MCF-7 whole cell, human Hela whole cell, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse Neuro-2a whole cell. IHC: human spleen tissue, human gastric carcinoma tissue, human placenta tissue. ICC/IF: T-47D cell. Flow: ANA-1 cell, RH35 cell, U937 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Rab11A is a member of the YPT-1 subfamily of Ras-related GTP-binding proteins. Rab11A mRNA has been detected in a variety of tissues including brain, testis, spleen, heart, and gastrointestinal mucosa. In the gastric fundus the Rab11A protein is expressed in parietal cell tubulovesicles membranes. Expression of the Rab11A protein appears to occur in discrete epithelial cell populations where it localizes to apical vesicular populations. Recent studies have shown Rab11A is essential for resecretion of alpha-synuclein out of neuronal cells via endosome recycling and is required for exocytosis of discoidal/fusiform vesicles of bladder umbrella cells. Rab11A is also implicated in biogenesis of Birbeck granules and endosomal activation of the PI3K/AKT signaling pathway via G beta gamma trafficking.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RAB11A
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Monoclonal
Clone 4H9
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene RAB11A
Gene Accession No. P62491, P62492, P62494
Gene Alias 24KG; RAB 11A, member oncogene family; RAB11; rab-11; rab11 GTP-binding protein; Rab11a; RAB11a, member RAS oncogene family; ras-related protein Rab-11A; tubulovesicle-associated protein; YL8
Gene Symbols RAB11A
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 53869, 81830, 8766
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.