Invitrogen™ RAB11A Monoclonal Antibody (4H9)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549197

Catalog No. PIMA549197

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse and rat sequences. Positive Control - WB: human 293T whole cell, human SH-SY5Y whole cell, human MCF-7 whole cell, human Hela whole cell, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse Neuro-2a whole cell. IHC: human spleen tissue, human gastric carcinoma tissue, human placenta tissue. ICC/IF: T-47D cell. Flow: ANA-1 cell, RH35 cell, U937 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Rab11A is a member of the YPT-1 subfamily of Ras-related GTP-binding proteins. Rab11A mRNA has been detected in a variety of tissues including brain, testis, spleen, heart, and gastrointestinal mucosa. In the gastric fundus the Rab11A protein is expressed in parietal cell tubulovesicles membranes. Expression of the Rab11A protein appears to occur in discrete epithelial cell populations where it localizes to apical vesicular populations. Recent studies have shown Rab11A is essential for resecretion of alpha-synuclein out of neuronal cells via endosome recycling and is required for exocytosis of discoidal/fusiform vesicles of bladder umbrella cells. Rab11A is also implicated in biogenesis of Birbeck granules and endosomal activation of the PI3K/AKT signaling pathway via G beta gamma trafficking.

Specifications

• Antigen: RAB11A
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4 mg trehalose and no preservative
• Gene Accession No.: P62491, P62492, P62494
• Gene Symbols: RAB11A
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 4H9
• Conjugate: Unconjugated
• Gene: RAB11A
• Gene Alias: 24KG; RAB 11A, member oncogene family; RAB11; rab-11; rab11 GTP-binding protein; Rab11a; RAB11a, member RAS oncogene family; ras-related protein Rab-11A; tubulovesicle-associated protein; YL8
• Host Species: Mouse
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 53869, 81830, 8766
• Content And Storage: -20°C
• Form: Lyophilized