Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB11FIP5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RAB11FIP5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179582
|
Novus Biologicals
NBP179582 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RAB11FIP5 Polyclonal specifically detects RAB11FIP5 in Human samples. It is validated for Western Blot.Specifications
| RAB11FIP5 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp434H018, Gaf-1, GAF1rab11-FIP5, Gamma-SNAP-associated factor 1, KIAA0857gaf-1, Phosphoprotein pp75, pp75, RAB11 family interacting protein 5 (class I), Rab11-FIP5, Rab11-interacting protein Rip11, RAB11RIP5, RIP11rab11 family-interacting protein 5 | |
| RAB11FIP5 | |
| IgG | |
| Affinity Purified | |
| 70 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_056285 | |
| 26056 | |
| Synthetic peptide directed towards the N terminal of human RAB11FIP5The immunogen for this antibody is RAB11FIP5. Peptide sequence MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title