Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB11FIP5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	RAB11FIP5
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179582 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179582	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

RAB11FIP5 Polyclonal specifically detects RAB11FIP5 in Human samples. It is validated for Western Blot.

Specifications

Antigen	RAB11FIP5
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_056285
Gene ID (Entrez)	26056
Immunogen	Synthetic peptide directed towards the N terminal of human RAB11FIP5The immunogen for this antibody is RAB11FIP5. Peptide sequence MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	DKFZp434H018, Gaf-1, GAF1rab11-FIP5, Gamma-SNAP-associated factor 1, KIAA0857gaf-1, Phosphoprotein pp75, pp75, RAB11 family interacting protein 5 (class I), Rab11-FIP5, Rab11-interacting protein Rip11, RAB11RIP5, RIP11rab11 family-interacting protein 5
Gene Symbols	RAB11FIP5
Isotype	IgG
Molecular Weight of Antigen	70 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RAB11FIP5 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents