Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ RAB13 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579902
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579902 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579902 Supplier Invitrogen™ Supplier No. PA579902
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human CACO-2 whole cell, human MCF-7 whole cell, human 293T whole cell. ICC/IF: MCF-7 cell. Flow: U87 cell.

RAB13 can participate in polarized transport, in the assembly and/or the activity of tight junctions.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RAB13
Applications Flow Cytometry, Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene RAB13
Gene Accession No. P51153
Gene Alias 0610007N03Rik; B230212B15Rik; Cell growth-inhibiting gene 4 protein; GIG4; growth-inhibiting gene 4 protein; Rab13; RAB13, member RAS oncogene family; RAS-associated protein RAB13; ras-related protein Rab-13
Gene Symbols RAB13
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5872
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.