Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579903

Invitrogen™ RAB14 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579903
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579903 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579903 Supplier Invitrogen™ Supplier No. PA579903
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, RAJI whole cell, SMMC whole cell.

Localized to biosynthetic and endosomal compartments, Rab14 is involved in the biosynthetic/recycling pathway between the Golgi and endosomal compartments.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RAB14
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene RAB14
Gene Accession No. P61106, P61107
Gene Alias 0610030G24Rik; 2810475J17Rik; A830021G03Rik; AI314285; AI649155; bA165P4.3 (member RAS oncogene family); cb731; D030017L14Rik; F protein-binding protein 1; FBP; fc26g11; fj47f07; fj68a01; GTPase Rab14; Rab14; RAB-14; RAB14, member RAS oncogene family; ras-related protein Rab-14; small GTP binding protein RAB14; wu:fc26g11; wu:fj47f07; wu:fj68a01
Gene Symbols RAB14
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51552, 94197
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.