RAB34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP187177

Catalog No. NBP187177

Description

RAB34 Polyclonal specifically detects RAB34 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RAB34
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: RAB34, member RAS oncogene family, RAHRAB39Ras-related protein Rab-39, ras-related protein Rab-34, Ras-related protein Rah
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RAB34
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 83871
• Target Species: Human
• Isotype: IgG

For Research Use Only