Invitrogen™ RAB6A Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595528

Catalog No. PIPA595528

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human MDA-MB-453 whole cell, human SK-OV-3 whole cell, Human A431 whole cell, rat testis tissue, mouse brain tissue, mouse HEPA1-6 whole cell. IHC: human placenta tissue, rat small intestine tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Rab proteins are also an integral part of endocytic pathways. Rab 6A is a ubiquitously expressed member of the Rab family of proteins and localizes to the Golgi membrane where it regulates retrograde transport from the late endosomes via the Golgi to endoplasmic reticulum (ER) pathway. Three isoforms exist due to alternative splicing events, namely the ubiquitously expressed isoforms Rab 6A' and Rab 6A, and the brain-specific isoform Rab 6B.

Specifications

• Antigen: RAB6A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: RAB6A
• Gene Alias: 2610028L11Rik; AA419671; MNCb-1660; Rab GTPase; Rab6; rab-6; RAB6, member RAS oncogene family; RAB6A; RAB6A, member RAS oncogene family; Rab6b; RAB6B, member RAS oncogene family; ras-related protein Rab-6A; RCO4-3
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 19346, 5870, 84379
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P20340, P35279, Q9WVB1
• Gene Symbols: RAB6A
• Immunogen: A synthetic peptide corresponding to a sequence of human RAB6A (RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG