Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    RAB6B Rabbit anti-Human, Polyclonal, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309950100UL
Description
RAB6B Polyclonal specifically detects RAB6B in Human samples. It is validated for Western Blot.Specifications
| RAB6B | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| RAB6B, member RAS oncogene family, ras-related protein Rab-6B, small GTPase RAB6B, small GTP-binding protein | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB6B. Peptide sequence AKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGC | |
| 100 μg | |
| Signal Transduction | |
| 51560 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | 
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            Spot an opportunity for improvement?Share a Content Correction