RAB8A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179960

Catalog No. NBP179960

Description

RAB8A Polyclonal antibody specifically detects RAB8A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RAB8A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: mel transforming oncogene (derived from cell line NK14), mel transforming oncogene (derived from cell line NK14)- RAB8 homolog, MELras-associated protein RAB8, Oncogene c-mel, RAB8A, member RAS oncogene family, RAB8mel transforming oncogene (RAB8 homolog), ras-related protein Rab-8A
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Mouse: 85%; Rat: 85%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_005361
• Gene Symbols: RAB8A
• Immunogen: Synthetic peptide directed towards the middle region of human RAB8AThe immunogen for this antibody is RAB8A. Peptide sequence GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4218
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only