Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

A2M Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant A2M.

Supplier:  Abnova Corporation PAB28545

Catalog No. 89-130-055


Add to Cart

Description

Description

Alpha-2-macroglobulin is a protease inhibitor and cytokine transporter. It inhibits many proteases, including trypsin, thrombin and collagenase. A2M is implicated in Alzheimer disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. [provided by RefSeq

Sequence: SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS
Specifications

Specifications

A2M
Polyclonal
Rabbit polyclonal antibody raised against recombinant A2M.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
P01023
A2M
Recombinant protein corresponding to amino acids of recombinant A2M.
100 μL
Primary
Human
Liquid
Immunohistochemistry, Western Blot, Western Blot
Unconjugated
Immunohistochemistry(1:200-1:500) Western Blot(-) The optimal working dilution should be determined by the end user.
A2M
CPAMD5/DKFZp779B086/FWP007/S863-7
Rabbit
Antigen affinity purification
RUO
2
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only