Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123698

ABCB5 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89123698 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-698 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-698 Supplier Abnova Corporation Supplier No. PAB21990

Description

Rabbit polyclonal antibody raised against recombinant ABCB5.

ABCB5 belongs to the ATP-binding cassette (ABC) transporter superfamily of integral membrane proteins. These proteins participate in ATP-dependent transmembrane transport of structurally diverse molecules ranging from small ions, sugars, and peptides to more complex organic molecules (Chen et al., 2005 [PubMed 15760339]).[supplied by OMIM

Sequence: DLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLL

Specifications

Antigen ABCB5
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Description ATP-binding cassette, subfamily B (MDR/TAP), member 5
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene ABCB5
Gene Accession No. Q2M3G0
Gene Alias ABCB5alpha, ABCB5beta, EST422562
Gene Symbols ABCB5
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human ABCB5.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 340273
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.