ADA Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-935	100 μL

Catalog No. 89-129-935 Supplier Abnova Corporation Supplier No. PAB28429

Description

Rabbit polyclonal antibody raised against recombinant ADA.

This gene encodes an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia. [provided by RefSeq

Sequence: GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE

Specifications

• Antigen: ADA
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant ADA.
• Dilution: Immunohistochemistry(1:500-1:1000) Western Blot(1:100-1:250) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: ADA
• Gene Accession No.: P00813
• Gene Symbols: ADA
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of recombinant ADA.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 100
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only