ADAMTS10, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-125-346	100 μL

Catalog No. 89-125-346 Supplier Abnova Corporation Supplier No. PAB23637

Description

Rabbit polyclonal antibody raised against recombinant ADAMTS10.

This gene belongs to the ADAMTS (a disintegrin and metalloproteinase domain with thrombospondin type-1 motifs) family of zinc-dependent proteases. ADAMTS proteases are complex secreted enzymes containing a prometalloprotease domain of the reprolysin type attached to an ancillary domain with a highly conserved structure that includes at least one thrombospondin type 1 repeat. They have been demonstrated to have important roles in connective tissue organization, coagulation, inflammation, arthritis, angiogenesis and cell migration. The product of this gene plays a major role in growth and in skin, lens, and heart development. It is also a candidate gene for autosomal recessive Weill-Marchesani syndrome. [provided by RefSeq

Sequence: SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK

Specifications

• Antigen: ADAMTS10
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant ADAMTS10.
• Dilution: Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: ADAMTS10
• Gene Accession No.: Q9H324
• Gene Alias: ADAM-TS10/WMS
• Gene Symbols: ADAMTS10
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human ADAMTS10.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 81794
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only