Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89131656

ADM, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89131656 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
150 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-131-656 150 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-131-656 Supplier Abnova Corporation Supplier No. PAB4972
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against synthetic peptide of ADM.

Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element. [provided by RefSeq]

Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Specifications

Antigen ADM
Applications ELISA, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against synthetic peptide of ADM.
Dilution The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ADM
Gene Alias AM
Gene Symbols ADM
Host Species Rabbit
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human ADM.
Quantity 150 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 133
Target Species Human
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.