AGPS Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-123	100 μL

Catalog No. 89-124-123 Supplier Abnova Corporation Supplier No. PAB22415

Description

Rabbit polyclonal antibody raised against recombinant AGPS.

This gene is a member of the FAD-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (DHAP) is converted to alkyl-DHAP by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires FAD as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and Zellweger syndrome. [provided by RefSeq

Sequence: QIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLH

Specifications

• Antigen: AGPS
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant AGPS.
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: AGPS
• Gene Accession No.: O00116
• Gene Alias: ADAP-S/ADAS/ADHAPS/ADPS/ALDHPSY/DKFZp762O2215/FLJ99755
• Gene Symbols: AGPS
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human AGPS.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8540
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only