Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALAS2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ALAS2

Supplier:  Abnova Corporation PAB28468

Catalog No. 89-129-975


Add to Cart

Description

Description

The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHAS
Specifications

Specifications

ALAS2
Polyclonal
Rabbit polyclonal antibody raised against recombinant ALAS2
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
P22557
ALAS2
Recombinant protein corresponding to amino acids of human ALAS2
100 μL
Primary
Human
Liquid
Immunohistochemistry (PFA fixed)
Unconjugated
Immunohistochemistry(1:20-1:50) The optimal working dilution should be determined by the end user.
ALAS2
ALAS-E/ALASE/ANH1/ASB/FLJ93603/XLSA
Rabbit
Antigen affinity purification
RUO
212
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only