ALDH1A3, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ALDH1A3.

Supplier:  Abnova Corporation PAB24490

Catalog No. 89-126-208

Description

Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The enzyme encoded by this gene uses retinal as a substrate, either in a free or cellular retinol-binding protein form. [provided by RefSeq

Sequence: ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN

Specifications

• Antigen: ALDH1A3
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant ALDH1A3.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: P47895
• Gene Symbols: ALDH1A3
• Immunogen: Recombinant protein corresponding to amino acids of human ALDH1A3.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: ALDH1A3
• Gene Alias: ALDH1A6/ALDH6/RALDH3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 220
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only