Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALMS1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89125725 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-125-725 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-125-725 Supplier Abnova Corporation Supplier No. PAB24022
Add to Cart
Add to Cart

Rabbit polyclonal antibody raised against recombinant ALMS1.

This gene encodes a protein containing a large tandem-repeat domain. The mouse ortholog of this gene has been shown to function in ciliogenesis in inner medullary collecting duct cells. Mutations in this gene have been associated with Alstrom syndrome. Alternative splice variants have been described but their full length sequences have not been determined

Sequence: DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP

Specifications

Antigen ALMS1
Applications Immunofluorescence, Immunohistochemistry (PFA fixed)
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant ALMS1.
Dilution Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene ALMS1
Gene Accession No. Q8TCU4
Gene Alias ALSS/DKFZp686A118/DKFZp686D1828/KIAA0328
Gene Symbols ALMS1
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human ALMS1.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7840
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.