ANAPC13 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-126-187	100 μL

Catalog No. 89-126-187 Supplier Abnova Corporation Supplier No. PAB24470

Description

Rabbit polyclonal antibody raised against recombinant ANAPC13.

This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined. [provided by RefSeq

Sequence: MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVP

Specifications

• Antigen: ANAPC13
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant ANAPC13.
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: ANAPC13
• Gene Accession No.: Q9BS18
• Gene Alias: APC13/DKFZp566D193/SWM1
• Gene Symbols: ANAPC13
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human ANAPC13.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 25847
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only