ANGPT1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-122-666	100 μL

Catalog No. 89-122-666 Supplier Abnova Corporation Supplier No. PAB21173

Description

Rabbit polyclonal antibody raised against recombinant ANGPT1.

Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The protein encoded by this gene is a secreted glycoprotein that activates the receptor by inducing its tyrosine phosphorylation. It plays a critical role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme. The protein also contributes to blood vessel maturation and stability, and may be involved in early development of the heart. [provided by RefSeq

Sequence: EKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFR

Specifications

• Antigen: ANGPT1
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant ANGPT1.
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: ANGPT1
• Gene Accession No.: Q15389
• Gene Alias: AGP1/AGPT/ANG1
• Gene Symbols: ANGPT1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human ANGPT1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 284
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only