Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANO2 Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89124674 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-124-674 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-124-674 Supplier Abnova Corporation Supplier No. PAB22974

Rabbit polyclonal antibody raised against recombinant ANO2.

Sequence: PTDISDQIKKEKSLLVDFFLKEEHEKLKLMDEPALRSPGGGDRSRSRAASSAPSGQSQLGSMMSSGSQHTNV

Specifications

Antigen ANO2
Applications Immunofluorescence, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description anoctamin 2
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene ANO2
Gene Accession No. Q9NQ90
Gene Alias C12orf3, DKFZp434P102, TMEM16B
Gene Symbols ANO2
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human ANO2.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57101
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.