APEX1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-103	100 μL

Catalog No. 89-130-103 Supplier Abnova Corporation Supplier No. PAB28591

Description

Rabbit polyclonal antibody raised against recombinant APEX1.

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq]

Sequence: KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD

Specifications

• Antigen: APEX1
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant APEX1.
• Dilution: Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/ml) Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: APEX1
• Gene Accession No.: G3V3M6
• Gene Alias: APE/APE-1/APE1/APEN/APEX/APX/HAP1/REF-1/REF1
• Gene Symbols: APEX1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human APEX1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 328
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only