APOO, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant APOO.

Supplier:  Abnova Corporation PAB20174

Catalog No. 89-121-678

Description

This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16

Sequence: IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Specifications

• Antigen: APOO
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant APOO.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q9BUR5
• Gene Symbols: APOO
• Immunogen: Recombinant protein corresponding to amino acids of human APOO.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: APOO
• Gene Alias: FAM121B/MGC4825/MYO25/My025
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 79135
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only