ARID4B Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-597	100 μL

Catalog No. 89-123-597 Supplier Abnova Corporation Supplier No. PAB21892

Description

Rabbit polyclonal antibody raised against recombinant ARID4B.

This gene encodes a protein with sequence similarity to retinoblastoma-binding protein-1. The encoded protein is a subunit of the histone deacetylase-dependant SIN3A transcriptional corepressor complex, which functions in diverse cellular processes including proliferation, differentiation, apoptosis, oncogenesis, and cell fate determination. The gene product is recognized by IgG antibody isolated from a breast cancer patient and appears to be a molecular marker associated with a broad range of human malignancies. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq

Sequence: DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR

Specifications

• Antigen: ARID4B
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant ARID4B.
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: ARID4B
• Gene Accession No.: Q4LE39
• Gene Alias: BCAA/BRCAA1/DKFZp313M2420/MGC163290/RBBP1L1/RBP1L1/SAP180
• Gene Symbols: ARID4B
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human ARID4B.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51742
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only